PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009615387.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 498aa    MW: 55688.2 Da    PI: 7.7084
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009615387.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.35e-3183140260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDg++WrKYGqK vkgs+fprsYY+Ct+++Cpv+kkve++  +++v+ei+Y+g Hnh+k
  XP_009615387.1  83 DDGFTWRKYGQKRVKGSNFPRSYYKCTQQSCPVRKKVECAP-NGQVIEIVYNGAHNHPK 140
                     8****************************************.***************85 PP

2WRKY102.52.3e-32291348259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK+vkg+++prsYY+Ct agC v+k+ver++++ k v++tYeg+Hnhe
  XP_009615387.1 291 EDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCIVRKHVERASDNLKSVITTYEGKHNHE 348
                     8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.7E-2772140IPR003657WRKY domain
SuperFamilySSF1182905.1E-2480140IPR003657WRKY domain
SMARTSM007742.3E-3382140IPR003657WRKY domain
PROSITE profilePS5081121.57483141IPR003657WRKY domain
PfamPF031061.1E-2483139IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-34275350IPR003657WRKY domain
SuperFamilySSF1182907.45E-28283350IPR003657WRKY domain
PROSITE profilePS5081136.862285350IPR003657WRKY domain
SMARTSM007742.7E-36290349IPR003657WRKY domain
PfamPF031068.3E-25291348IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MSSPPCWPAV LTIPPGISPA ALLDSPVMFP SSVTPTETNV QQTLNSIELT NKQIPQQEEF  60
TKKENQFEQN GVFSSSISPS SSDDGFTWRK YGQKRVKGSN FPRSYYKCTQ QSCPVRKKVE  120
CAPNGQVIEI VYNGAHNHPK TQSIRRPNMD NSYVIREVEE IGQENASVWR NQQFECNKNV  180
ISYNDNGLKR TSSASVLTEV SDPMSTNPKS MNVFESAGTP ELSSTLTSYD GDDGDWATQE  240
STLLGDDVNE YELEPKRRKK ESYSAEPSLL SRTVRESKVV LQVESEIDIL EDGYRWRKYG  300
QKVVKGNPNP RSYYKCTNAG CIVRKHVERA SDNLKSVITT YEGKHNHEVP TANKTNGVAG  360
HIRSASTLNG QPNCMTTRKS VKGSNCRMQV QDLPFPFERK PFVGSEYLRP SFVGSYLGDL  420
SFGACSLQLP NFPLPLPSRM SFPARLNEPP LGDFHLNNHH LLPNGTSNSF LAVGNMQHIN  480
DDNNNSSLLK AKEEIQWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-3283350877Probable WRKY transcription factor 4
2lex_A1e-3283350877Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1254260PKRRKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2387898e-48AC238789.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 5 clone C05HBa0142A20, complete sequence.
GenBankHG9754448e-48HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755178e-48HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615387.10.0PREDICTED: probable WRKY transcription factor 4 isoform X1
RefseqXP_009615388.10.0PREDICTED: probable WRKY transcription factor 4 isoform X1
RefseqXP_009615389.10.0PREDICTED: probable WRKY transcription factor 4 isoform X1
TrEMBLM1C5480.0M1C548_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000600420.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57672237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.14e-75WRKY DNA-binding protein 4